<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4914 CA17483 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NFV+ DDI+ D4T 20
2 SQV+ AZT+ RTV 4
3 3TC+ AZT+ NFV+ NVP 9
4 3TC+ NFV+ NVP 16
5 3TC+ NVP 26
6 EFV 8
7 EFV+ ABC 9
8 IDV+ ABC+ 3TC+ RTV 32
9 APV+ AZT+ DDI 35

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L76V, V82A L10F N37D, D60E, I62V, L63P, A71V, V77I, I93L  
>CA17483| codons 1-99
PQITLWQRPFVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKIIGGIGGFVKVRQYE
QVPIEICGHKVIGTVVIGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, T69S_SG, V75M, L210W, T215Y   Y188L   K122E, R172K, I178M, Q207E, R211K, A272P, K277R, T286A, A288AG, V292I K281*L
>CA17367| codons 1-298
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSSKWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDMVI
YQYMDDLLVGSDLEIGQHRTKIEELREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCLLLRGAKGLTEIIPLTEE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003