<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7126 CA17478 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+IDV 82

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y       K43N, S68G, I135T, T200A, E203K, Q207E, I293V, E297K, V317A, I326V, I329V, G359S, A371V, T403M, E404D, L452M, V466I, S468P, L469I, L491S, K530R F160FC, Y232Y*, L246LGRV
>CA17478| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELENEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAICQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIKELREHLLRWGFYTPDKKHQKEPPFLWMG*ELHPDKWT
VQPIVVPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTKEAE
LELAENREILKEPVHGAYYDPSKDLVAEVQKQGQGQWTYQIYQEPFKNLKTGKYARMRSA
HTNDVKQLTEVVQKIATESIVIWGKTPKFKLPIQKETWEAWWMDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKMGKAGYVTDRGRQKIVPITDTTNQKTELQ
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKERVYLAWVPAHK
GIGGNEQVDKLVSAGIRKVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M   L10R, K20I, E35D, M36I, N37S, R57K, I62V, L63P, I64V, I72X, I93L, C95F  
>CA17603| codons 1-99
PQITLWQRPRVTIKIGGQLIEALLDTGADDTVLEDISLPGRWKPKIIGGIGGFIKVKQYD
QVPVEICGHKAXGTVLVGPTPVNIIGRNLMTQLGFTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005