<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+ABC+AZT 25
2 D4T+DDI+EFV 24
3 ABC+LPV+TDF 44
4 LPV+SQV+TDF 36

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    Q7H, L10V, I15V, E35D, L63P, T74S, I93L  
>RG487w128| codons 1-99
PQITLWHRPVVTIKVGGQLKEALLDTGADDTVLEDMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGSVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Gulick, RM Triple-nucleoside regimens versus efavirenz-containing regimens for the initial treatment of HIV-1 infection. N Engl J Med, 2004