<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7118 CA17467 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+RTV+SQV 78
2 D4T+DDI+EFV 104

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69S_SS, M184MI, L210LW, T215Y A62V, D67E Y188L, G190GA   V35VL, K43E, V90VI, A98S, V106I, V118VI, K122E, I135T, V189VI, R211K, L228H, E233ED, K238KR, T286A, E297R, A304G S268SR, A299AG
>CA17467| codons 1-304
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALLEICTELEEEGKISKIGPENPYNTPV
FVIKKKESSKWRKLVDFRELNKRTQDFWEIQLGIPHPSGLKKKKSITVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYIDDLLIASDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFHWMGYDLHPDRWT
VQPIVLPEKDSWTVNDIQKLVGKLNWARQIYAGIKVKQLCKLLRGAKALTEVIPLTREGE
LELG

References
Author Title Citation
Gonzales, MJ Colinearity of reverse transcriptase inhibitor resistance mutations detected by population-based sequencing. JAIDS, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005