<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+AZT+EFV 156

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N P225H K43E, A98S, K101Q, K122P, I142V, S162SN, Q174K, D177E, I178L, T200E, R211T, V245E  
>RG455w156| codons 38-247
CTEMEEEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
SGLQKNKSVTVLDVGDAYFSVPLDPDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSP
AIFQNSMTKILEPFRKKNPELVIYQYVDDLYVGSDLEIGQHREKIEELRQHLLTWGFTTP
DKKHQKEHPFLWMGYELHPDKWTVQPIELP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, L63A, H69Q, V77I  
>RG455w156| codons 4-99
TLWQRPLVTIKVGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQIA
IEICGQKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Gulick, RM Triple-nucleoside regimens versus efavirenz-containing regimens for the initial treatment of HIV-1 infection. N Engl J Med, 2004