<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7108 CA17450 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 117
2 3TC+D4T+IDV 52
3 3TC+D4T+NFV+NVP 39
4 Unknown 137

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74I, T215F   K103N, Y181C, G190A K238T V8I, K43N, E44D, V111I, V118I, K122E, I135T, G196E, T200A, E203D, H208Y, R211K, H221Y, L228LH, V245L, A272P, K277R, V292I, I293V, E297K  
>CA17450| codons 1-304
PISPIETIPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELENDGKISKIGPENPYNTPV
FAIKKKNSDKWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDIGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYMDDLYVASDLEIEQHRAKIDELRQYLLKWGFFTPDKKYQKEPPFHWMGYELHPDTWT
VQPILLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEIVPLTKEAE
LELA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I3IN, L10I, M36I, R41K, L63P, I64V, I93L  
>CA17575| codons 1-99
PQNTLWQRPIVTIKIGGQLKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIPVEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005