<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7106 CA17448 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+3TC 139
2 D4T+DDI+EFV 42

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y   Y181C, G190A K238KT K43EQ, E44X, K101X, K166R, T200I, Q207E, R211K, R284K, I293V, P294T, A304G  
>CA17448| codons 1-304
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEEXGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLXKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
CQYMDDLYVASDLEIGQHRIKIEELREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDTWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLKGTKALTEVVTLTEEAE
LELG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I62V, L63P, V77I, I93L  
>CA17574| codons 15-99
IGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQVPIEICGHKAIGT
VLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005