<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1802 CA17429 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 104
2 DDI 104
3 AZT+ 3TC 104
4 RTV+ D4T+ 3TC 34
5 SQV+ RTV+ DDI+ D4T 47
6 SQV+ RTV+ EFV+ D4T+ ADV+ 3TC 21
7 3TC+ ADV+ EFV+ D4T 4
8 3TC+ ADV+ EFV+ D4T+ RTV+ SQV 42
9 RTV+ SQV+ 3TC+ EFV+ D4T 8
10 SQV+ EFV+ D4T+ 3TC 7
11 None 21
12 3TC+ EFV+ SQV+ D4T+ NRTI 17

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, T215Y   K101P, K103N   K20R, V60I, S68G, V118I, D121H, K122E, I135K, D177E, I202V, R211K, V245E, E291D, V292I, I293V, A304G S48V, K281KE
>CA17429| codons 1-304
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKEGKIVKIGPENPYNTPI
FAIKKKDGTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLPKNKSVTVLDVGDAYFSIPL
HEDFRKYTAFTIPSKNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRTKVEELRQHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCELLRGTKALTDIVPLTEEAE
LELG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, I84V L24I L10I, T12P, K14R, L63P, A71I, V77I  
>CA17555| codons 1-99
PQITLWQRPIVPIRIGGQLKEALIDTGADDTVLEEMNLPGRWKPKMIGGIGGFVKVRQYD
QIPIEICGHKIIGTVLIGPTPANVIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012