<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4060 CA17428 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 78
2 3TC+AZT 178
3 3TC+ABC+AZT 58

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74I, M184V, T215F K219Q   A98G V60I, I135V, D177E, G196E, D218E, V245T, I293V, I326LV, I329V, A371V, T386I, T403R, V435VI, V467VI, L491LS, V531I, A534AS, A554T D256DV, K390Q
>CA17428| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKIVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIEQHRTKIEELRQHLLRWGFFTPEQKHQKEPPFLWMGYELHPDKWT
VQPITLPEKDSWTVNVIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLVAEVQKQGQGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVKQLTEVVQKIATESIVIWGKIPKFQLPIQKETWEAWWREYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIIGAETFYVDGAANRETKLGKAGYVTDRGRQKVISLTDTTNQKTELQ
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKIYLSWVPAHK
GIGGNEQVDKLVSTGIRKVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, G16E, E35D, N37NS, I62V, L63P  
>CA17553| codons 1-99
PQITLWQRPLVTIKVEGQLKEALLDTGADDTVLEDMSLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009