<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7087 CA17427 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 109
2 3TC+AZT 30
3 3TC+D4T+DDI 30
4 3TC+D4T+NFV 175

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219Q     V35T, K49KR, V60I, D123E, I135T, V179I, G196E, F214L, D218E, V245M, K249Q R143RK
>CA17427| codons 1-263
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIKYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYVDDLYVGSDLEIEQHRTKIEELRQHLLRWGLTTPEQKHQKEPPFLWMGYELHPDKWT
VQPIMLPEQDSWTVNDIQKLVGK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
N88S Q58E L10V, I13V, K20I, M46X, I62V, L63P, V77I  
>CA17577| codons 1-99
PQITLWQRPVVTVKIGGQLIEALLDTGADDTVLEEMNLPGRWKPKXIGGIGGFIKVREYD
QVPIEICGHKAIGTVLIGPTPVNIIGRSLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009