<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7078 CA17416 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 83
2 3TC+AZT 96
3 3TC+AZT+IDV 52
4 NVP+RTV+SQV 105

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103KN, Y181C V108I V35VA, K49R, T69N, K102Q, D123E, I135IV, K166I, I178L, H221HY, E224ED, T240TP, K277R, Q278H, I293V K281KE, A299AG
>CA17416| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALAEICTEMEKEGKISRIGPENPYNTPV
FAIKKKDSNKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQNKSVTILDVGDAYFSVPL
DKEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTIILEPFRKQNPDLVI
CQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKYQKDPPFLWMGYELHPDKWP
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRHLCELLRGTKALTEVVPLTEEGE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13IV, I15IV, I72IV, I93IL  
>CA17541| codons 1-99
PQITLWQRPLVTVKVGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAVGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009