<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+ABC+AZT 36
2 DDI+EFV+TDF 18
3 None 7
4 ATV+DDI+RTV+TDF 11

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N, G190A   V90I, D123E, K173N, Q174K, D177E, V189VI, I195L, R211K, E248EK N136T, G152D, F171FS
>RG328w71| codons 1-255
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSITNETPGIRYQYNVLPQDWKGSPAIFQSSMTKILEPSRNKNPEIVI
YQYMDDLYIASDLELGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPKKDSWTVN

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, N37D, R57K, I62V, L63P, A71T  
>RG328w71| codons 14-99
KIGGQLKEALLDTGADDTVLEDMDLPGRWKPKMIGGIGGFIKVKQYDQVPIEICGHKTIG
TVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Gulick, RM Triple-nucleoside regimens versus efavirenz-containing regimens for the initial treatment of HIV-1 infection. N Engl J Med, 2004