<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RG31 RG31w176 U.S. 2005 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ABC+AZT 121
2 DDI+EFV+FTC+TDF 54

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74IV, Y115F, M184V, T215Y   Y181YC, Y188L   T39A, V60I, K64R, D123E, I142T, E169D, T200A, L210LS, H221Y K223KI
>RG31w176| codons 38-247
CAELEKEGKISKIGPENPYNTPIFAIRKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAFFSVPLDKEFRKYTAFTIPSINNETPGTRYQYNVLPQGWKGSP
AIFQSSMTKILDPFRKQNPDIVICQYVDDLLVGSDLEIGQHRAKIEELRQHLSRWGFYTP
DKKYQIEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, L19T, N37S, L63P  
>RG31w176| codons 4-99
TLWQRPLVTVKIGGQTKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQIP
IEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Gulick, RM Triple-nucleoside regimens versus efavirenz-containing regimens for the initial treatment of HIV-1 infection. N Engl J Med, 2004