<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RG31 RG31w112 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ABC+AZT 112

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Y115F, M184V, T215Y       T39TA, V60I, K64R, D123E, I142T, E169D, L228R  
>RG31w112| codons 38-247
CAEMEKEGKISKIGPENPYNTPIFAIRKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAFFSVPLDKEFRKYTAFTIPSINNETPGTRYQYNVLPQGWKGSP
AIFQSSMTKILDPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFYTP
DKKHQKEPPFRWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, L19T, E34EK, N37S, L63P  
>RG31w112| codons 4-99
TLWQRPLVTVKIGGQTKEALLDTGADDTVLKEMSLPGRWKPKMIGGIGGFIKVRQYDQIP
IEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Gulick, RM Triple-nucleoside regimens versus efavirenz-containing regimens for the initial treatment of HIV-1 infection. N Engl J Med, 2004