<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5195 CA17403 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI 208
2 SQV+ RTV+ DDC 73
3 NVP+ NFV+ D4T 130
4 SQV+ RTV+ D4T+ 3TC 35

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y K219KR   F227L K20R, V35L, T39A, E44D, V118I, K122E, E203K, Q207E, H208Y, R211K, K223E, K277R, Q278H, R284K, A288S, I293V L289LR
>CA17403| codons 1-300
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALLEICAELEKDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIKELREYLWKWGFYTPDRKHQEEPPLLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRHLCKLLKGTKSRTEVVPLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46ML, G48EV, I54V, V82F, L90LM K43T L10I, I13V, I15V, E35D, M36I, N37S, I62V, L63T, I64V, I72V, V77VI W6W*
>CA17528| codons 1-99
PQITL*QRPIVTVKVGGQLKEALLDTGADDTVLEDISLPGRWTPKLIVGIGGFVKVRQYD
QVTVEICGHKAVGTVLIGPTPFNIIGRNLMTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005