<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6368 CA17396 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T 52
2 D4T+DDI+NVP 134

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, L210W, T215Y K219N K103N, Y181C, G190A   V35T, K43E, E44A, V118I, I135V, S162D, R172RK, H208Y, R211K, V245M, E248Q  
>CA17396| codons 1-255
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTELEEAGKISKIGPENPYNTPV
FAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQDSMTKILEPFKKQNPDIVI
CQYMDDLYVASDLEIGQHRTKIEELRQYLWKWGFYTPDNKHQKEPPFLWMGYELHPDKWT
VQPIMLPQKDSWTVN

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    N37S, R41K, L63P, I72V, V77I, I93L  
>CA17522| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAVGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005