<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RG287 RG287w18 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ABC+AZT+EFV 18

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12P, K14KR, G16GE, M36L, I62V, L63S, I64V  
>RG287w18| codons 4-99
TLWQRPLVPIRIEGQLKEALLDTGADDTVLEELNLPGRWKPKMIGGIGGFIKVRQYDQVS
VEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N V75I, K219Q Y188Y*FL, G190GE   S48E, V90I, K102KR, I135IV, D177DG, V179I, G196EK, R211K, D218E, V245E  
>RG287w18| codons 38-247
CTEMEKEGKIEKIGPENPYNTPVFAIKKKNSTKWRKLIDFRELNKRTQDFWEIQLGIPHP
AGLKRKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPGIIIYQYMDDLLVESDLEIKQHRTKIEELRQHLLKWGFTTP
EQKHQKEPPFLWMGYELHPDKWTVQPIELP

References
Author Title Citation
Gulick, RM Triple-nucleoside regimens versus efavirenz-containing regimens for the initial treatment of HIV-1 infection. N Engl J Med, 2004