<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+ABC+AZT 29
2 3TC+ABC+AZT+TDF 17
3 3TC+ABC+AZT+NFV+TDF 10
4 3TC+ABC+AZT+TDF 64

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    N37D, K55E, R57K, I62V, L63S, K70KE, I72V, V77I, Q92QH  
>RG285w118| codons 37-99
DLPGRWKPKMIGGIGGFIEVKQYDQVSIEICGHEAVGTVLIGPTPVNIIGRNLLTHIGCT
LNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        I50V, K103KR, K122P, I135T, I142A, R211K, F214L L12F
>RG285w118| codons 1-250
PISPIETVPVKFKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKVGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPL
DPDFRKYTAFTIPSTNNETPGARYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKD

References
Author Title Citation
Gulick, RM Triple-nucleoside regimens versus efavirenz-containing regimens for the initial treatment of HIV-1 infection. N Engl J Med, 2004