<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+ABC+AZT+EFV 18
2 None 7
3 3TC+AZT+DDI+EFV 15

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        S48E, K101R, D123E, T165TI, D177E, R211K K219K*
>RG260w41| codons 38-247
CTEMEKEGKIEKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLRKKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMIKILEPFRKQNPEIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTP
D*KHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    M36MI, L38I, I62V, L63P, I64L  
>RG260w41| codons 4-99
TLWQRPLVTIKIGGQLKEALLDTGADDTVLEEINIPGRWKPKMIGGIGGFIKVRQYDQVP
LEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Gulick, RM Triple-nucleoside regimens versus efavirenz-containing regimens for the initial treatment of HIV-1 infection. N Engl J Med, 2004