<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA606 CA17381 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 209
2 DDI 82
3 D4T 39
4 3TC+AZT 17
5 3TC+AZT+SQV 9
6 3TC+AZT+IDV 57
7 3TC+D4T+RTV+SQV 40
8 3TC+D4T+EFV+RTV+SQV+Unknown 13
9 3TC+D4T+RTV+SQV 28
10 3TC+D4T+SQV 77

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y       K20R, A98S, K122E, A158S, V245E, A272P, L283I, I293V A299AG
>CA17381| codons 1-303
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLIRGTKALTEVVPLTEEGE
LEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M G73S L10I, K20I, N37D, I62V, L63P, K70R, A71T, I72T  
>CA17506| codons 1-99
PQITLWQRPIVTIKIGGQLIEALLDTGADDTVLEEMDLPGRWKPKIIGGIGGFIKVRQYD
QVPIEICGHRTTSTVLVGPTPVNVIGRNLMTQIGCTLNF

References
Author Title Citation
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005