<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+ABC+AZT 122

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V T215I, K219E   Y188YD E6EG, K11KN, V35T, T39N, E40K, K64N, K102R, S134SR, T139R, I142T, S163ST, K166KE, E169EQ, T200A, E203K, R211G, F214L  
>RG252w121| codons 1-240
PISPIGTVPVNLKPGMDGPKVKQWPLTEEKIKALTEICNKMEKEGKISKIGPENPYNTPV
FAINKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPRINNERPGTRYQYNVLPQGWKGSPAIFQSTMTEILQPFRKQNPDIVI
YQYVDDLDVGSDLEIGQHRAKIKELRQHLLGWGLITPDEKHQKEPPFLWMGYELHPDKWT

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T4TI, K14KR, N37D, L63P, V77I, I93L  
>RG252w121| codons 1-99
PQIILWQRPLVTIRIGGQLKEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Gulick, RM Triple-nucleoside regimens versus efavirenz-containing regimens for the initial treatment of HIV-1 infection. N Engl J Med, 2004