<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+AZT+EFV 97
2 None 14
3 3TC+ATV+AZT 8

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L19T, E35D, N37D, L63S, A71T  
>RG247w119| codons 1-99
PQITLWQRPLVTIKIGGQTKEALLDTGADDTVLEDMDLPGRWKPKMIGGIGGFIKVRQYD
QISIEICGHKTIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        D86E, K102Q, S162C, E204Q, R211K  
>RG247w119| codons 1-243
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQEFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEQLRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQP

References
Author Title Citation
Gulick, RM Triple-nucleoside regimens versus efavirenz-containing regimens for the initial treatment of HIV-1 infection. N Engl J Med, 2004