<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4351 CA17377 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT 34
2 3TC+ AZT+ IDV 21
3 DDI+ IDV 47
4 D4T+ 3TC+ RTV+ SQV 70
5 ABC+ AZT+ 3TC 11
6 ABC+ DDI+ EFV 52

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N   R83K, V90I, K102R, D123E, T139M, I178L, R211K, I293V, E297A A299AG
>CA17377| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEIQLGIPHPAGLKRNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNEMPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDLVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTAEGE
LEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E21EK, E35D, I62V, L63P, I64L, I93L R8RQ
>CA17502| codons 1-99
PQITLWQRPLVTIKIGGQLKKALLDTGADDTVLEDMNLPGRWKPKMIGGIGGFIKVRQYD
QVPLEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005