<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+ABC+AZT 1
2 None 6
3 3TC+ABC+AZT 2
4 3TC+DDI+EFV 1
5 None 7
6 3TC+DDI+EFV 18

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74I, M184V   V106M V179D, F227FL I37X, I142T, Q207A, R211K, D237DN, V245VIM  
>RG205w35| codons 37-247
VCTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKIVDFRELNKRTQDFWEVQLGIPH
PAGLKKKKSMTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGTRYQYNVLPQGWKGS
PAIFQSSMTKILEPFRKQNPDIDIYQYVDDLYVGSDLEIGQHRTKIEELRAHLLKWGFTT
PDKKHQKEPPLLWMGYELHPNKWTVQPIMLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, N37A, I64V  
>RG205w35| codons 4-99
TLWQRPLVTIKVGGQLKEALLDTGADDTVLEEMALPGRWKPKMIGGIGGFIKVRQYDQIL
VEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Gulick, RM Triple-nucleoside regimens versus efavirenz-containing regimens for the initial treatment of HIV-1 infection. N Engl J Med, 2004