<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1455 CA17361 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ AZT 183
2 D4T 56
3 SQV+ D4T 21
4 DDC+NFV+NVP 90
5 SQV+ RTV+ EFV+ ABC 27
6 EFV+ DDI+ D4T 94

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K70R, L74V, M184V, L210W, T215Y D67G, K219E K101E, Y181V, G190A   E28A, V60I, S68G, K103KR, V106I, L109I, V118I, K122E, I135T, I178M, D218E, Q242K A299AG
>CA17361| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTAEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKGGTRWRKVVDFRELNKRTQDFWEVQLGIPHPAGLEKRKSITVIDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
VQYVDDLYVASDLEIGQHRTKIEELRQHLWRWGFYTPEEKHQKEPPFLWMGYELHPDKWT
VKPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVIPLTEEGE
LEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84IV, L90LM   L10LI, I15V, L19LP, K20KI, E35D, M36MI, R41K, L63P, A71AV  
>CA17495| codons 1-99
PQITLWQRPIVTIKVGGQPIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGHKVIGTVLVGPTPVNVIGRNLMTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005