<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7052 CA17358 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 4
2 DDI+ D4T 134
3 DDI+ D4T 37

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65KR, Q151M A62V, V75I, F77L     A33V, V35T, S68G, K122E, D123N, I178L, T200A, H221HY, E248D, A272P, Q278QE, I293V, A304G A299AG
>CA17358| codons 1-304
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKVLTEICTEMEKEGKISKIGPENPYNTPV
FVIKRKDGTKWRKLIDLRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFRKQNPDLVI
YQYMDDLYVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKKYQKEPPFLWMGYELHPDKWT
VQPIVLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKELCKLLRGTKALTEVVPLTEEGE
LELG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, G16E, E35D, I62V, L63Q  
>CA17492| codons 1-99
PQITLWQRPLVTIKVEGQLKEALLDTGADDTVLEDMNLPGRWKPKMIGGIGGFIKVRQYD
QVQIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Gonzales, MJ Colinearity of reverse transcriptase inhibitor resistance mutations detected by population-based sequencing. JAIDS, 2003
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005