<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SE7108 SE7108 Sweden 1994 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 AZT+DDI 152

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215Y K219Q     V35T, V60I, D121H, K122E, D123E, I135T, K173S, Q174K, D177E, I178L, V179I, T200I, Q207E, R211K, K238R, V245K, D250E, L282C, T286A, V292I, I293V, G335D, T338S, P345Q, F346Y, R356K, M357L, A360T, V365I, E370A, T377Q, S379C, K390R, A400T, E432D, V435A, A437V, V458I, H483N, L491P, K512R, S519N, Q524K, K527G, E529D, A534S, A554S  
>SE7108| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPELII
YQYMDDLYVGSDLEIGQHRIKIEELREHLLKWGFYTPDQKHQKEPPFLWMGYELHPDRWT
VQPIKLPEKESWTVNDIQKLVGKLNWASQIYAGIKVKQLCKCLRGAKALTEIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQDQWSYQIYQEQYKNLKTGKYAKLRGT
HTNDIKQLTAAVQKIAQECIVIWGKTPKFRLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIAGVETFYVDGAANRETKLGKAGYITDRGRQKVVSLTDTTNQKTELQ
AINLALQDSGPEVNIVTDSQYALGIIQAQPDRSESELVNQIIEKLIGKDKVYLSWVPAHK
GIGGNEQVDKLVSSGIRKVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, E35D, M36I, R41K, R57K, H69K, L89M  
>SE7108| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K14R, V31I, I72V, L101I, T112V, T124A, T125A, K136Q, D167E, V201I, Q216H S283G
>SE7108| codons 1-288
FLDGIDKAQEEHERYHSNWRAMASDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKVIHTDNGSN
FTSAAVKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIGQVREQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKHITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

References
Author Title Citation
Carr, JK Characterization of subtype A HIV-1 from Africa by full genome sequencing. AIDS, 1999