<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+ABC+AZT 123
2 3TC+ABC+AZT+EFV 5

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11N, V35T, E36A, T39D, K49KR, V60I, A98S, K122E, D123G, I135T, A158S, K173A, Q174K, T200A, Q207E, V245Q, A272P, E291D, V292I, I293V, P294T  
>RG133w127| codons 1-300
PISPIETVPVNLKPGMDGPKVKQWPLTEEKIKALTAICDEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRAKNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTDIVTLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    M36I, R41K, Q61QH, H69K, L89M, I93L  
>RG133w127| codons 23-99
LLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDHILIEICGKKAIGTVLVGPTPV
NIIGRNMLTQLGCTLNF

References
Author Title Citation
Gulick, RM Triple-nucleoside regimens versus efavirenz-containing regimens for the initial treatment of HIV-1 infection. N Engl J Med, 2004