<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+ABC+AZT 96
2 3TC+ABC+AZT+TDF 44

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, V75T, M184V     V108I D123E, I142V, T165L, D177E, R211Q, K277R, K281R, T286A K30R
>RG12w140| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEERIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLTDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTILDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMLKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLQWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCRLLRGAKALTEVIPLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12P, G16E, N37E, I62V, L63Q, V77I, I93L  
>RG12w140| codons 1-99
PQITLWQRPLVPIKIEGQLKEALLDTGADDTVLEEMELPGRWKPKMIGGIGGFIKVRQYD
QVQIEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Gulick, RM Triple-nucleoside regimens versus efavirenz-containing regimens for the initial treatment of HIV-1 infection. N Engl J Med, 2004