<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, E35D, M36I, R41K, L63I, H69K, L89M  
>29742| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QIIIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6K, V35T, E36A, T39E, E40D, K49R, D121E, K122E, D123S, A158S, K166R, K173A, D177E, T200A, Q207E, V245K, T286A, E291D, V292I, I293V, I326V D113DG
>29742| codons 1-334
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEDMEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGGAYFSVPL
EESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTRILEPFRAQNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLVAEIQKQGQ

References
Author Title Citation
Kasang, C HIV drug resistance (HIVDR) in antiretroviral therapy-naive patients in Tanzania not eligible for WHO threshold HIVDR survey is dramatically high. PLoS ONE, 2011