<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AICPS033 AICPS033 Uganda 2009 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I13V, I15V, L19I, K20T, R41K, L63P, I64V, I72V, V77I  
>AICPS033| codons 1-99
PQITLWQRPLVSVKVGGQITEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIPVEICGHKAVGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Ndembi, N Transmitted antiretroviral drug resistance among newly HIV-1 diagnosed young individuals in Kampala. AIDS, 2011