<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
EC24 EC24PF U.S. 1995 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 D4T+DDI 48

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N       A158S, Q207E, V245M, E312N, I329V, G333E, E344G, M357T, A376P, V381I, K390R, P421S, L425I, D460DN, S468PT, H483HY, K512KQ, S519SN W266R
>EC24PF| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNRASQIYAGIKVKQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKNPVHGVYYDPSKDLIAEVQKQEQGQWTYQIYQGPFKNLKTGKYARTRGA
HTNDVKQLTEAVQKIPTESIIIWGKTPKFRLPIQKETWEAWWTEYWQATWIPEWEFVNTP
SLVKIWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVPLTDTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRKVL

References
Author Title Citation
Coakley, EP Phenotypic and genotypic resistance patterns of HIV-1 isolates derived from individuals treated with didanosine and stavudine. AIDS, 2000
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005