<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, G17E, K20I, E35N, M36I, R41K, H69K, K70R, L89M  
>1822| codons 1-99
PQITLWQRPLVTVRIGEQLIEALLDTGADDTVLENINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35I, K122E, D123S, E138A, I142V, S162A, K173T, Q174K, T200A, Q207E, F214L, V245Q  
>1822| codons 8-248
VPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPVFAIKKKD
STKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDESFRKY
TAFTIPSINNATPGVRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPDIVIYQYMDDL
YVGSDLEIGQHRAKIEELREHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIQLP
E

References
Author Title Citation
El Annaz, H Presence of drug resistance mutations among drug-naive patients in Morocco. ARHR, 2011