<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
patco_84 patco_84 Guinea 2009 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K101E V108I, E138K, V179E V35T, V60I, T69S, K122Q, I135L, S162A, R172RK, K173I, Q174K, D177E, T200A, I202IV, Q207G, R211T  
>patco_84| codons 27-220
TEEKIKALTEICTEMEKEGKISKIGPENPYNTPIFAIKKKDSSKWRKLVDFRELNKRTQD
FWEVQLGIPHPAGLEKKKSVTILDVGDAYFSVPLDQDFRKYTAFTIPSLNNKTPGIRYQY
NVLPQGWKGSPAIFQASMTKILEPFKIKNPEIEIYQYMDDLYVGSDLEIGQHRAKVEELR
GHLLTWGFTTPDKK

References
Author Title Citation
Charpentier, C High prevalence of antiretroviral drug resistance among HIV-1-untreated patients in Guinea-Conakry and in Niger. Antivir Ther, 2011