<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
patco_03 patco_03 Guinea 2009 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35VAIT, E36D, T39TAIV, K49R, V60I, S68G, K122KE, D123DN, I135IT, S162A, K173T, Q174K, D177E, I178M, T200A, I202IV, Q207X, R211K, F214FL  
>patco_03| codons 21-220
VKQWPLTEEKIKALTDICVEMEKEGKISRIGPENPYNTPIFAIKKKDGTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDENFRKYTAFTIPSTNNETP
GIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEMVIYQYMDDLYVGSDLEIGQHRA
KVEELRXHLLKWGLTTPDKK

References
Author Title Citation
Charpentier, C High prevalence of antiretroviral drug resistance among HIV-1-untreated patients in Guinea-Conakry and in Niger. Antivir Ther, 2011