<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
patng_39 patng_39 Niger 2009 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V21I, V35T, E40D, V60I, T69S, D121H, K122E, K173R, Q174K, D177E, T200TA, I202V, Q207DN, R211K, P243T, V245K, E248D, D250E K30E, I31P
>patng_39| codons 12-250
LKPGMDGPKIKQWPLTEEEPKALTEICTDMEKEGKISKIGPENPYNTPIFAIKKKDSSKW
RKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLHEDFRKYTAFT
IPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRRKNPEIVIYQYMDDLYVGS
DLEIGQHRAKVEELRNHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQTIKLPDKE

References
Author Title Citation
Charpentier, C High prevalence of antiretroviral drug resistance among HIV-1-untreated patients in Guinea-Conakry and in Niger. Antivir Ther, 2011