<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20R, V35T, T39Q, V60I, V118I, K122E, D123DN, I135T, T139TAS, I142IT, Q174DGNS, D177E, I178M, T200A, Q207E, F214L, L228Q, V245Q, E248N, D250E R78RK
>patng_14| codons 10-250
VKLKPGMDGPRVKQWPLTEEKIKALTEICQEMEKEGKISKIGPENPYNTPIFAIKKKDST
KWRKLVDFKELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPLDENFRKYTA
FTIPSTNNESPGTRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKSNPEMVIYQYMDDLYV
GSDLEIGQHRAKIEELREHLLRWGLTTPDKKHQKEPPFQWMGYELHPDKWTVQPIQLPNK
E

References
Author Title Citation
Charpentier, C High prevalence of antiretroviral drug resistance among HIV-1-untreated patients in Guinea-Conakry and in Niger. Antivir Ther, 2011