<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, I15V, L19I, K20I, L23X, M36I, R41K, I64M, C67N, H69K, I72IM, L89M  
>D351cT| codons 1-99
PQITLWQRPIVTVKVGGQIIEAXLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILMEINGKKAMGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, V35T, E36D, T39L, K122E, I135V, S162A, K173A, Q174K, T200A, Q207E, R211K, V245Q, K281R, T286A, E291D, V292I, I293V, P294T, S322A, G335D, F346Y, R356K, M357K, G359S, K366R, A371AV, A376T, E399D, A400T, T403M  
>D351cT| codons 1-407
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALTDICLEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRAKNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCRLLRGAKALTDIVTLTEEAE
LELAENREILKEPVHGVYYDPAKDLIAEIQKQGQDQWTYQIYQEPYKNLKTGKYAKKRSA
HTNDVRQLTEVVQKITTESIVIWGKTPKFKLPIQKETWDTWWMEYWQ

References
Author Title Citation
Chamberland, A Transmission of HIV-1 drug resistance in Benin could jeopardise future treatment options. Sex Transm Infect, 2012