<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
D345T D345T Benin 2009 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12A, I13V, K14R, G16E, K20I, M36I, R41K, L63P, H69K, K70R, I72V, V77I, L89M  
>D345T| codons 1-99
PQITLWQRPLVAVRIEGQLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKRAVGTVLIGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
      V179E K20R, V35T, S48T, V60I, K102KQ, K122E, I135T, T165I, K173A, Q174K, D177E, I178M, T200A, Q207K, R211Q, V245K, A272P, K275Q, E291D, V292I, I293V, E297A, E312Q, E328D, F346Y, M357V, R358K, G359A, T377Q, T386I, K390R, A400T, E404D, E415X, F416Y  
>D345T| codons 1-419
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICTEMEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRAKNPEMEI
YQYMDDLYVGSDLEIGQHRAKIEELRKHLLQWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIQVKQLCKLLRGTKALTDIVPLTAEAE
LELAENREILKQPVHGVYYDPSKDLIADIQKQGQGQWTYQIYQEPYKNLKTGKYARVKAA
HTNDVKQLTEAVQKIAQESIVIWGKIPKFRLPIQKETWETWWTDYWQATWIPEWXYVNT

References
Author Title Citation
Chamberland, A Transmission of HIV-1 drug resistance in Benin could jeopardise future treatment options. Sex Transm Infect, 2012