<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, I15V, K20V, E35N, M36I, P39S, R41K, H69K, V77I, L89M Q2QL
>D315T| codons 1-99
PLITLWQRPLVTVRVGGQLVEALLDTGADDTVLENINLSGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLIGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20R, V35T, K122R, I135V, S162A, K173T, Q174R, D177E, T200A, E203D, Q207E, R211A, V245K, V261I, K277R, Q278N, T286A, E291D, V292I, I293V, S322T, I326V, G335D, R356K, M357K, G359S, A371V, I375V, K390R, T403M, E432D, V435M  
>D315T| codons 1-435
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DRDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTRNPEIVI
YQYMDDLYVGSDLEIGQHRAKIDELREHLLAWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLIGKLNWASQIYAGIKVRNLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPTKDLVAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKKRSA
HTNDVKQLTEVVQKVATESIVIWGKTPKFRLPIQKETWEAWWMEYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIM

References
Author Title Citation
Chamberland, A Transmission of HIV-1 drug resistance in Benin could jeopardise future treatment options. Sex Transm Infect, 2012