<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
O05-43 O05-43 Brazil 2008 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, G16E, E35D, N37K, R41N, R57K, D60E, Q61N, I64L, C67CW, H69K, V77I, L89M, I93L  
>O05-43| codons 1-99
PQITLWQRPLVTIKVEGQLKEALLDTGADDTVLEDMKLPGNWKPKMIGGIGGFIKVKQYE
NILLEIWGKKAIGTVLIGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E40D, K122E, I135T, S162Y, K173I, Q174K, T200A, R211K, F214L  
>O05-43| codons 1-234
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTDMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRIKNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELRQHLLKWGLTTPDKKHQKEPPFLWMGYEL

References
Author Title Citation
Carvalho, BC Moderate prevalence of transmitted drug resistance and interiorization of HIV type 1 subtype C in the inland north state of Tocantins, Brazil. ARHR, 2011