<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
O17-83 O17-83 Brazil 2008 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, T12Q, I15V, M36I, N37E, R57K, L63P, I72T, I93L  
>O17-83| codons 1-99
PQITLWQRPVVQIKVGGQLKEALLDTGADDTVLEEIELPGRWKPKMIGGIGGFIKVKQYD
QIPIEICGHKATGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        S48T, K49R, K122E, D123G, I135T, R211G  
>O17-83| codons 1-220
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKITRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLGWGFTTPDKK

References
Author Title Citation
Carvalho, BC Moderate prevalence of transmitted drug resistance and interiorization of HIV type 1 subtype C in the inland north state of Tocantins, Brazil. ARHR, 2011