<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
O07-83 O07-83 Brazil 2008 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, I15V, E35D, M36I, R41K, K45R, R57K, L63S, I64V  
>O07-83| codons 1-99
PQITLWQRPLVTIRVGGQLKEALLDTGADDTVLEDINLPGKWKPRMIGGIGGFIKVKQYD
QISVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20R, V35T, T39L, K66KR, I135L, S162C, K173T, Q174K, T200A, I202IV, Q207V, R211K K122MR
>O07-83| codons 1-244
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICLEMEKEGKISKIGPENPYNTPV
FAIKKRDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DRDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRTKNPDIVI
YQYMDDLYVGSDLEIGQHRAKVEELRVHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPI

References
Author Title Citation
Carvalho, BC Moderate prevalence of transmitted drug resistance and interiorization of HIV type 1 subtype C in the inland north state of Tocantins, Brazil. ARHR, 2011