<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
O01-43 O01-43 Brazil 2008 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, E35D, M36V, R41K, L63T  
>O01-43| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEDVNLPGKWKPKMIGGIGGFIKVRQYD
QITIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11S, I135V, S162C, E169D, K173T, Q174K, T200A, Q207E, F214L  
>O01-43| codons 1-244
PISPIETVPVSLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRTKNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPI

References
Author Title Citation
Carvalho, BC Moderate prevalence of transmitted drug resistance and interiorization of HIV type 1 subtype C in the inland north state of Tocantins, Brazil. ARHR, 2011