Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| r31 | r31_m0 | France | 1995 | HIV1 | F | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | NRTI | NA |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| I15V, Q18E, E35D, M36I, R41K, K43R, R57K |
| >r31_m0| codons 1-99 PQITLWQRPLVTIKVGGELKEALLDTGADDTVLEDINLPGKWRPKMIGGIGGFIKVKQYD QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF |
References
| Author | Title | Citation |
| Belec, L | High levels of drug resistance human immunodeficiency virus variants in patients exhibiting increasing CD4 + t cell counts despite virologic failure of protease inhibitors containing antiretroviral combination therapy. | J Infect Dis, 2000 |
| Wu, TD | Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. | J Virol, 2003 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |