<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
r31 r31_m0 France 1995 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 NRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, Q18E, E35D, M36I, R41K, K43R, R57K  
>r31_m0| codons 1-99
PQITLWQRPLVTIKVGGELKEALLDTGADDTVLEDINLPGKWRPKMIGGIGGFIKVKQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Belec, L High levels of drug resistance human immunodeficiency virus variants in patients exhibiting increasing CD4 + t cell counts despite virologic failure of protease inhibitors containing antiretroviral combination therapy. J Infect Dis, 2000
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005