<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 Unknown NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E11D, S24N, V31I, I60V, I72V, L101I, T112V, T124A, G134N, K136Q, D167E, T210S, Q216H, I220L, L234I S283G, D286N
>KTB119| codons 1-288
FLDGIDKAQEDHEKYHSNWRAMANDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGV
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKVIHTDNGSN
FTSATVKAACWWANIQQEFGIPYNPQSQGVVESMNKELKKIIGQVREQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQSKELQKHITKLQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVAGRQNED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    G16E, K20R, T31P, E35D, M36I, P39S, R41K, K43R, I62V, L63T, E65D, H69K, T74S, L89M  
>KTB119| codons 1-99
PQITLWQRPLVTIKIEGQLREALLDTGADDPVLEDINLSGKWRPKMIGGIGGFIKVRQYD
QVTIDICGKKAIGSVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39K, D123E, A158S, K173S, D177E, Q207A, R211K, V245Q, S251N, T286A, E291D, V292I, I293V, E312N, D324E, Q334H, G335E, R356K, M357R, G359S, A371V, K374R, I375V, E399D, V435I, V466I, V467I, D471E, Q480H, H483Y, L491S, I495V, K512R, L517V, S519N, Q524K, K527E, K530R, A534S, V548I, A554S, K558R  
>KTB119| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICKEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRSQNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELRAHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDNWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKNPVHGVYYDPSKELIAEIQKQGHEQWTYQIYQEPFKNLKTGKYAKRRSA
HTNDVKQLTEVVQRVATESIVIWGKTPKFKLPIQKETWDAWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIIGAETFYVDGAANRETKLGKAGYVTDRGRQKIISLTETTNQKTELH
AIYLALQDSGSEVNVVTDSQYALGIIQAQPDRSESEVVNQIIEKLIEKERVYLSWVPAHK
GIGGNEQIDKLVSSGIRRVL

References
Author Title Citation
Vidal, N Genetic characterization of eight full-length HIV type 1 genomes from the Democratic Republic of Congo (DRC) reveal a new subsubtype, A5, in the A radiation that predominates in the recombinant structure of CRF26_A5U. ARHR, 2009