Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| par10 | par10_m12 | France | 1996 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | NRTI | NA |
| 2 | NRTI+IDV | 52 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| M46I, L76V, V82F, L90M | L10I, N37D, L63P, I64V, I93L |
| >par10_m12| codons 1-99 PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKIIGGIGGFIKVRQYD QIPVEICGHKAIGTVVVGPTPFNIIGRNLMTQLGCTLNF |
References
| Author | Title | Citation |
| Belec, L | High levels of drug resistance human immunodeficiency virus variants in patients exhibiting increasing CD4 + t cell counts despite virologic failure of protease inhibitors containing antiretroviral combination therapy. | J Infect Dis, 2000 |
| Wu, TD | Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. | J Virol, 2003 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |
