<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6806 CA17102 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 157
2 3TC+AZT+IDV 26
3 3TC+AZT+NFV 166

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M K43KT I13V, K20T, E35D, M36MIV, I62V, L63P, I64V, T74S, V77I, V82I, I93L W6W*
>CA17102| codons 1-99
PQITL*QRPLVTVKIGGQLTEALLDTGADDTVLEDVNLPGRWTPKMIGGIGGFIKVRQYD
QVPVEICGHKAIGSVLIGPTPINIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y       T39A, E44ED, K122E, I142V, H208HY, R211K, S251T, V261VG, T286A, E297T  
>CA16856| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKDGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQYLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDTWTVNDIQKLGGKLNWASQIYAGIKVKQLCKLLRGAKALTEVIPLTTEAE

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001