<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 Unknown NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E11D, S17T, A23V, L101I, S119P, I135V, F181L, T206S, Y227F, L234I, D256E, V260I  
>CY018| codons 1-288
FLDGIDKAQEDHEKYHTNWRAMVSDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKTIHTDNGPN
FTSTTVKAACWWAGVKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
LIHNFKRKGGIGGYSAGERIVDIIASDIQTKELQKQITKIQNFRVYFRDSRDPIWKGPAK
LLWKGEGAVVIQDNSEIKVIPRRKAKIIRDYGKQMAGDDCVASRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, L90M L10F K20I, E35D, M36I, N37D, R57K, D60E, L63P, A71V, I93L  
>CY018| codons 1-99
PQITLWQRPFVTIKIGGQLIEALLDTGADDTVLEDIDLPGRWKPKIIGGIGGFVKVKQYE
QIPIEICGHKVIGTVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69~, L74V, Q151M A62V K103N, Y181C, G190A V108I S68G, V90I, K102Q, D123E, T165I, Q174K, D177E, D192N, I202V, F214L, H221Y, V245M, T286A, E297K, I326V, E328K, Q334L, M357T, V381I, T386I, K388R, A400L, K451R, H483Y I63V, Q182H
>CY018| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FVVKKKDG~KWRKVVDFRELNKRTQDFWEIQLGIPHPAGLKQNKSVTILDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQSSMIKILEPFRKKNPEIVI
CHYMDDLYVASNLEIGQHRTKVEELRQHLLRWGLTTPDKKYQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVIPLTKEAE
LELAENREILKEPVHGVYYDPSKDLVAKIQKQGLGQWTYQIYQEPFKNLKTGKYARTRGA
HTNDVKQLTEAVQKIATESIIIWGKIPRFKLPIQKETWELWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETRLGKAGYVTDRGRQKVVSLTDTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRKVL

References
Author Title Citation
Kousiappa, I Near full-length genetic analysis of HIV sequences derived from Cyprus: evidence of a highly polyphyletic and evolving infection. ARHR, 2009