<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
9 9w24 France 2006 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 3TC+NVP+TDF 24

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R   Y181C, G190A   T39N, K122E, D123G, E169D, K173A, Q174K, D177E, G196E, Q207A, R211S, V245Q G51GR, G213GR
>9w24| codons 38-247
CNEMEKEGKISKIRPENPYNTPVFAIKRKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILDPFRAKNPEIVICQYMDDLYVASDLEIEQHRTKIEELRAHLLSWRFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIQLP

References
Author Title Citation
Rey, D High rate of early virological failure with the once-daily tenofovir/lamivudine/nevirapine combination in naive HIV-1-infected patients. AAC, 2009